NBP1-70618 LOC652825 antibody

See related secondary antibodies

Search for all "LOC652825"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LOC652825

Product Description for LOC652825

Rabbit anti Human LOC652825.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC652825

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B4P0M3
Immunogen:
Synthetic peptides corresponding to LOC652825 The peptide sequence was selected from the middle region of LOC652825. Peptide sequence QSRSFRILWLLEEIKQPYELKRYYRDSSTHLAPDSLKTIHPLGKSPVLEW.
GeneID:
6528252
Background The exact function of LOC652825 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 6528252

Accessory Products

  • LinkedIn