
NBP1-70618 LOC652825 antibody

See related secondary antibodies

Search for all "LOC652825"

Quick Overview

Rabbit anti Human LOC652825

Product Description for LOC652825

Rabbit anti Human LOC652825.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC652825

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to LOC652825 The peptide sequence was selected from the middle region of LOC652825. Peptide sequence QSRSFRILWLLEEIKQPYELKRYYRDSSTHLAPDSLKTIHPLGKSPVLEW.
Background The exact function of LOC652825 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 6528252

Accessory Products

  • LinkedIn