
NBP1-70619 LOC653186 antibody

See related secondary antibodies

Search for all "LOC653186"

0.1 mg / €360.00

Quick Overview

Rabbit anti Human LOC653186

Product Description for LOC653186

Rabbit anti Human LOC653186.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC653186

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to LOC653186(hypothetical LOC653186) The peptide sequence was selected from the N terminal of LOC653186. Peptide sequence MKVINAKLDGFYSFPIFLFQFLQATAQEEGIFECADPKLAISAIWTFRDL.
Background The function remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
Gene ID 6531860

Accessory Products

  • LinkedIn