discontinued

NBP1-70619 LOC653186 antibody

See related secondary antibodies

Search for all "LOC653186"

Quick Overview

Rabbit anti Human LOC653186

Product Description for LOC653186

Rabbit anti Human LOC653186.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC653186

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B4P9Q1
Immunogen:
Synthetic peptides corresponding to LOC653186(hypothetical LOC653186) The peptide sequence was selected from the N terminal of LOC653186. Peptide sequence MKVINAKLDGFYSFPIFLFQFLQATAQEEGIFECADPKLAISAIWTFRDL.
GeneID:
6531860
Background The function remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified
Gene ID 6531860

Accessory Products

  • LinkedIn