H00727811-B01P LOC727811 antibody

See related secondary antibodies

Search for all "LOC727811"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human LOC727811

H00727811-B01P

Product Description for LOC727811

Mouse anti Human LOC727811.
Product is tested for Western blot / Immunoblot.

Properties for LOC727811

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC116710, MGC34104
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
LOC727811 (ABM83028.1, 1 a.a. ~ 344 a.a) full-length human protein.
AA Sequence:
MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIY LLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITS VLAWVTAILATLPEYVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLR FREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLD GTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
GeneID:
727811
Add. information Mouse polyclonal antibody raised against a full-length human LOC727811 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn