H00083459-B01P LOC83459 antibody

See related secondary antibodies

Search for all "LOC83459"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human LOC83459

H00083459-B01P

More Views

  • H00083459-B01P

Product Description for LOC83459

Mouse anti Human LOC83459.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for LOC83459

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC88636, hypothetical protein LOC83459
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
LOC83459 (AAH16958.1, 1 a.a. ~ 180 a.a) full-length human protein.
AA Sequence:
MPALEGAPHTPPLPRRPRKGSSELGFPRVAPEDEVIVNQYVIRPGPSASAASSAAAGEPLECPTCGHSYNVTQRRP RVLSCLHSVCEQCLQILYESCPKYKFISCPTCRRETVLFTDYGLAALAVNTSILSRLPPEALTAPSGGQWGAEPEG SCYQTFRQYCGAACTCHVRNPLSACSIM
Remarks:
Gene Accession: NM_031297.2
Add. information Mouse polyclonal antibody raised against a full-length human LOC83459 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn