discontinued

NBP1-54372 Low Density LRP antibody

See related secondary antibodies

Search for all "Low Density LRP"

50 µg / €390.00

Quick Overview

Rabbit anti Human Low Density LRP

Product Description for Low Density LRP

Rabbit anti Human Low Density LRP.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Low Density LRP

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PJ72
Immunogen:
Synthetic peptides corresponding to LRP1(low density lipoprotein-related protein 1 (alpha-2-macroglobulin receptor)) The peptide sequence was selected from the middle region of LRP1. Peptide sequence ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGD
Background Low-density lipoprotein receptor-related protein 1 (.-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn