H00125336-B01P LOXHD1 antibody

See related secondary antibodies

Search for all "LOXHD1"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human LOXHD1

H00125336-B01P

Product Description for LOXHD1

Mouse anti Human LOXHD1.
Product is tested for Western blot / Immunoblot.

Properties for LOXHD1

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ32670, LH2D1
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IVV2
Immunogen:
LOXHD1 (AAH47720.1, 1 a.a. ~ 512 a.a) full-length human protein.
AA Sequence:
MTVWTGDVVGGGTDSNIFMTLYGINGSTEEMQLDKKKARFEREQNDTFIMEILDIAPFTKMRIRIDGLGSRPEWFL ERILLKNMNTGDLTMFYYGDWLSQRKGKKTLVCEMCAVIDEEEMMEWTSYTVAVKTSDILGAGTDANVFIIIFGEN GDSGTLALKQSANWNKFERNNTDTFNFPDMLSLGHLCKLRVWHDNKGIFPGWHLSYVDVKDNSRDETFHFQCDCWL SKSEGDGQTVRDFACANNKICDELEETTYEIVIETGNGGETRENVWLILEGRKNRSKEFLMENSSRQRAFRKGTTD TFEFDSIYLGDIASLCVGHLAREDRFIPKRELVWHVKTITITEMEYGNVYFFNCDCLIPLKRKRKYFKVFEVTKTT ESFASKVQSLVPVKYEVIVTTGYEPGAGTDANVFVTIFGANGDTGKRELKQKMRNLFERGSTDRFFLETLELGELR KVRLEHDSSGYCSGWLVEKVEVTNTSTGVATIFNCGRWLDKKRGDGLTWRDLFPSV
GeneID:
125336
Add. information Mouse polyclonal antibody raised against a full-length human LOXHD1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn