NBP1-93621 LRIG2 antibody

See related secondary antibodies

Search for all "LRIG2"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LRIG2

NBP1-93621

More Views

  • NBP1-93621

Product Description for LRIG2

Rabbit anti Human LRIG2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for LRIG2

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O94898
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: IPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYIHKGTDGGTGTRVICSDCYDNANIYSRTREYCPYTYIAEEDVLDQTLSSLMVQMPKETYLVHPPQDTTALESLIPSANREPSAFPTNHERISEKKLPSTQMSGETLQRPVWNINRELGLPHPPFSQQPVHESPQLHQNEGLAGREPDCSASSMSCHRLQDHAF
GeneID:
9860
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 9860

Accessory Products

Proteins and/or Positive Controls

Positive controls for LRIG2 (1 products)

Catalog No. Species Pres. Purity   Source  

LRIG2 overexpression lysate

LRIG2 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn