TA335615 LRRC14 antibody

Rabbit Polyclonal Anti-LRRC14 Antibody

See related secondary antibodies

Search for all "LRRC14"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LRRC14

Product Description for LRRC14

Rabbit anti Human LRRC14.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LRRC14

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms KIAA0014, Leucine-rich repeat-containing protein 14
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-LRRC14 Antibody is: synthetic peptide directed towards the N-terminal region of Human LRRC14. Synthetic peptide located within the following region: QQLLQECAHCSRALLQERPSTESMQAVILGLTARLHTSEPGASTQPLCRK.
Application WB
Background LRRC14 belongs to the PRAME family and contains 6 LRR (leucine-rich) repeats
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for LRRC14 (3 products)

Catalog No. Species Pres. Purity   Source  


LRRC14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.


LRRC14 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


LRRC14 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for LRRC14 (1 products)

Catalog No. Species Pres. Purity   Source  

LRRC14 Lysate

Western Blot: LRRC14 Lysate [NBL1-12675] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for LRRC14.
  Novus Biologicals Inc.
  • LinkedIn