H00079782-B01P LRRC31 antibody

See related secondary antibodies

Search for all "LRRC31"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human LRRC31

H00079782-B01P

Product Description for LRRC31

Mouse anti Human LRRC31.
Product is tested for Western blot / Immunoblot.

Properties for LRRC31

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ23259, FLJ40019
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UY01
Immunogen:
LRRC31 (ADR83061.1, 1 a.a. ~ 552 a.a) full-length human protein.
AA Sequence:
MSQTRKKTSSEGETKPQTSTVNKFLRGSNAESRKEDNDLKTSDSQPSDWIQKTATSETAKPLSSEMEWRSSMEKNE HFLQKLGKKAVNKCLDLNNCGLTTADMKEMVALLPFLPDLEELDISWNGFVGGTLLSITQQMHLVSKLKILRLGSC RLTTDDVQALGEAFEMIPELEELNLSWNSKVGGNLPLILQKFQKGSKIQMIELVDCSLTSEDGTFLGQLLPMLQSL EVLDLSINRDIVGSLNSIAQGLKSTSNLKVLKLHSCGLSQKSVKILDAAFRYLGELRKLDLSCNKDLGGGFEDSPA QLVMLKHLQVLDLHQCSLTADDVMSLTQVIPLLSNLQELDLSANKKMGSSSENLLSRLRFLPALKSLVINNCALES ETFTALAEASVHLSALEVFNLSWNKCVGGNLKLLLETLKLSMSLQVLRLSSCSLVTEDVALLASVIQTGHLAKLQK LDLSYNDSICDAGWTMFCQNVRFLKELIELDISLRPSNFRDCGQWFRHLLYAVTKLPQITEIGMKRWILPASQEEE LECFDQDKKRSIHFDHGGFQ
GeneID:
79782
Add. information Mouse polyclonal antibody raised against a full-length human LRRC31 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for LRRC31 (1 products)

Catalog No. Species Pres. Purity   Source  

Leucine rich repeat containing 31 (LRRC31)

Leucine rich repeat containing 31 (LRRC31) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for LRRC31 (1 products)

Catalog No. Species Pres. Purity   Source  

LRRC31 overexpression lysate

LRRC31 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn