H00116064-B01P LRRC58 antibody

See related secondary antibodies

Search for all "LRRC58"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human LRRC58

H00116064-B01P

Product Description for LRRC58

Mouse anti Human LRRC58.
Product is tested for Western blot / Immunoblot.

Properties for LRRC58

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms -
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96CX6
Immunogen:
LRRC58 (CAL38114.1, 1 a.a. ~ 371 a.a) full-length human protein.
AA Sequence:
MEEAGAAVVTAGEAELNWSRLSVSTETLESELEARGEERRGAREALLRLLLPHNRLVSLPRALGSGFPHLQLLDVS GNALTALGPELLALRGLRTLLAKNNRLGGPSALPKGLAQSPLCRSLQVLNLSGNCFQEVPASLLELRALQTLSLGG NQLQSIPAEIENLQSLECLYLGGNFIKEIPPELGNLPSLNYLVLCDNKIQSIPPQLSQLHSLRSLSLHNNLLTYLP REILNLIHLEELSLRGNPLVVRFVRDLTYDPPTLLELAARTIKIRNISYTPYDLPGNLLRYLGSASNCPNPKCGGV YFDCCVRQIKFVDFCGKYRLPLMHYLCSPECSSPCSSASHSSTSQSESDSEDEASVAARRMQKVLLG
GeneID:
116064
Add. information Mouse polyclonal antibody raised against a full-length human LRRC58 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for LRRC58 (1 products)

Catalog No. Species Pres. Purity   Source  

LRRC58 overexpression lysate

LRRC58 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn