discontinued

H00023639-B01P LRRC6 antibody

See related secondary antibodies

Search for all "LRRC6"

Quick Overview

Mouse anti Human LRRC6

Product Description for LRRC6

Mouse anti Human LRRC6.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for LRRC6

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms LRTP, Leucine-rich repeat-containing protein 6, Leucine-rich testis-specific protein, TSLRP, Testis-specific leucine-rich repeat protein
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86X45
Immunogen:
LRRC6 (NP_036604.2, 1 a.a. ~ 466 a.a) full-length human protein.
AA Sequence:
MGWITEDLIRRNAEHNDCVIFSLEELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIENVSKLKKLEYLNLALN NIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQHNIHLKELFLMGNPCASFDHYREFVVATLPQLKWLDGKEIEP SERIKALQDYSVIEPQIREQEKDHCLKRAKLKEEAQRKHQEEDKNEDKRSNAGFDGRWYTDINATLSSLESKDHLQ APDTEEHNTKKLDNSEDDLEFWNKPCLFTPESRLETLRHMEKQRKKQEKLSEKKKKVKPPRTLITEDGKALNVNEP KIDFSLKDNEKQIILDLAVYRYMDTSLIDVDVQPTYVRVMIKGKPFQLVLPAEVKPDSSSAKRSQTTGHLVICMPK VGEVITGGQRAFKSMKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPEPKIIPSEEDPTF EDNPEVPPLI
GeneID:
23639
Remarks:
Gene Accession: NM_012472
Add. information Mouse polyclonal antibody raised against a full-length human LRRC6 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 23639

Accessory Products

Proteins and/or Positive Controls

Proteins for LRRC6 (4 products)

Catalog No. Species Pres. Purity   Source  

LRRC6

LRRC6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

LRRC6 (full length, C-term DDK tag)

LRRC6 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / €399.00
  OriGene Technologies, Inc.

LRRC6

LRRC6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

LRRC6

LRRC6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for LRRC6 (3 products)

Catalog No. Species Pres. Purity   Source  

LRRC6 293T Cell Transient Overexpression Lysate(Denatured)

LRRC6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LRRC6 Lysate

Western Blot: LRRC6 Lysate [NBL1-12702] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LRRC6
  Novus Biologicals Inc.

LRRC6 overexpression lysate

LRRC6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn