TA335649 LRRC6 antibody

Rabbit Polyclonal Anti-LRRC6 Antibody

See related secondary antibodies

Search for all "LRRC6"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat LRRC6

Product Description for LRRC6

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat LRRC6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LRRC6

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms LRTP, Leucine-rich repeat-containing protein 6, Leucine-rich testis-specific protein, TSLRP, Testis-specific leucine-rich repeat protein
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-LRRC6 Antibody: synthetic peptide directed towards the middle region of human LRRC6. Synthetic peptide located within the following region: MKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPE.
Application WB
Background LRRC6 may be involved in spermatocytogenesis or prophase of meiosis.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for LRRC6 (4 products)

Catalog No. Species Pres. Purity   Source  


LRRC6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

LRRC6 (full length, C-term DDK tag)

LRRC6 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / €399.00
  OriGene Technologies, Inc.


LRRC6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


LRRC6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for LRRC6 (3 products)

Catalog No. Species Pres. Purity   Source  

LRRC6 293T Cell Transient Overexpression Lysate(Denatured)

LRRC6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LRRC6 Lysate

Western Blot: LRRC6 Lysate [NBL1-12702] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LRRC6
  Novus Biologicals Inc.

LRRC6 overexpression lysate

LRRC6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn