NBP1-90871 LRRC8C antibody

See related secondary antibodies

Search for all "LRRC8C"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LRRC8C

Product Description for LRRC8C

Rabbit anti Human LRRC8C.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for LRRC8C

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TDW0
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LERLSFSHNKIEVLPSHLFLCNKIRYLDLSYNDIRFIPPEIGVLQSLQYFSITCNKVESLPDELYFCKKLKTLKIGKNSLSVLSPKIGNLLFLSYLDVKGNHFEILPPELGDCRALKRAGLVVEDALFETL
GeneID:
84230
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 84230

Accessory Products

Proteins and/or Positive Controls

Proteins for LRRC8C (1 products)

Catalog No. Species Pres. Purity   Source  

Leucine rich repeat containing 8 family, member C (LRRC8C)

Leucine rich repeat containing 8 family, member C (LRRC8C) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for LRRC8C (1 products)

Catalog No. Species Pres. Purity   Source  

LRRC8C overexpression lysate

LRRC8C overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn