discontinued

H00009208-D01P LRRFIP1 antibody

See related secondary antibodies

Search for all "LRRFIP1"

Quick Overview

Rabbit anti Human, Mouse LRRFIP1

H00009208-D01P

More Views

  • H00009208-D01P

Product Description for LRRFIP1

Rabbit anti Human, Mouse LRRFIP1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for LRRFIP1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms GC-binding factor 2, GCF2, LRR FLII-interacting protein 1, Leucine-rich repeat flightless-interacting protein 1, TAR RNA-interacting protein, TRIP
Presentation Purified
Reactivity Hu, Ms
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q32MZ4
Immunogen:
LRRFIP1 (AAH10662.1, 1 a.a. ~ 105 a.a) full-length human protein.
AA Sequence:
MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDK TEELEVSNGHLVKRLEKMKANRSALLSQQ
GeneID:
9208
Remarks:
Gene Accession: BC010662.1
Add. information Rabbit polyclonal antibody raised against a full-length human LRRFIP1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ce,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse
Gene ID 9208

Accessory Products

Proteins and/or Positive Controls

Proteins for LRRFIP1 (5 products)

Catalog No. Species Pres. Purity   Source  

LRRFIP1 (transcript variant 4)

LRRFIP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

LRRFIP1

LRRFIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

LRRFIP1

LRRFIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

LRRFIP1

LRRFIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

LRRFIP1

LRRFIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for LRRFIP1 (3 products)

Catalog No. Species Pres. Purity   Source  

LRRFIP1 293T Cell Transient Overexpression Lysate(Denatured)

LRRFIP1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LRRFIP1 Lysate

Western Blot: LRRFIP1 Lysate [NBL1-12709] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LRRFIP1
  Novus Biologicals Inc.

LRRFIP1 overexpression lysate

LRRFIP1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn