discontinued

H00009208-M08 LRRFIP1 antibody

See related secondary antibodies

Search for all "LRRFIP1"

Quick Overview

Mouse anti Human LRRFIP1 3E1

H00009208-M08

More Views

  • H00009208-M08
  • H00009208-M08

Product Description for LRRFIP1

Mouse anti Human LRRFIP1 3E1.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for LRRFIP1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms GC-binding factor 2, GCF2, LRR FLII-interacting protein 1, Leucine-rich repeat flightless-interacting protein 1, TAR RNA-interacting protein, TRIP
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, WB
Clonality Monoclonal
Clone 3E1
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q32MZ4
Immunogen:
LRRFIP1 (NP_004726, 675 a.a. ~ 785 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
GVAKDNAKIDGATQSSPAEPKSEDADRCTLPEHESPSQDISDACEAESTERCEMSEHPSQTVRKALDSNSLENDDL SAPGREPGHFNPESREDTRGGNEKGKSKEDCTMS*
GeneID:
9208
Remarks:
Gene Accession: NM_004735
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant LRRFIP1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 9208

Accessory Products

Proteins and/or Positive Controls

Proteins for LRRFIP1 (5 products)

Catalog No. Species Pres. Purity   Source  

LRRFIP1 (transcript variant 4)

LRRFIP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

LRRFIP1

LRRFIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

LRRFIP1

LRRFIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

LRRFIP1

LRRFIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

LRRFIP1

LRRFIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for LRRFIP1 (3 products)

Catalog No. Species Pres. Purity   Source  

LRRFIP1 293T Cell Transient Overexpression Lysate(Denatured)

LRRFIP1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LRRFIP1 Lysate

Western Blot: LRRFIP1 Lysate [NBL1-12709] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LRRFIP1
  Novus Biologicals Inc.

LRRFIP1 overexpression lysate

LRRFIP1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn