TA339099 LRRFIP1 antibody

Rabbit Polyclonal Anti-Lrrfip1 Antibody

See related secondary antibodies

Search for all "LRRFIP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish LRRFIP1

Product Description for LRRFIP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish LRRFIP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LRRFIP1

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms GC-binding factor 2, GCF2, LRR FLII-interacting protein 1, Leucine-rich repeat flightless-interacting protein 1, TAR RNA-interacting protein, TRIP
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-Lrrfip1 antibody is: synthetic peptide directed towards the middle region of Mouse Lrrfip1. Synthetic peptide located within the following region: IREIKELNELKDQIQDVEGKYMQGLKEMKDSLAEVEEKYKKAMVSNAQLD.
Application WB
Background Transcriptiol repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. May control smooth muscle cells proliferation following artery injury through PDGFA repression. May also bind double-stranded R (By similarity). Positively regulates Toll-like receptor (TLR) sigling in response to agonist probably by competing with the negative FLII regulator for MYD88-binding.
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for LRRFIP1 (5 products)

Catalog No. Species Pres. Purity   Source  

LRRFIP1 (transcript variant 4)

LRRFIP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


LRRFIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


LRRFIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


LRRFIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


LRRFIP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for LRRFIP1 (3 products)

Catalog No. Species Pres. Purity   Source  

LRRFIP1 293T Cell Transient Overexpression Lysate(Denatured)

LRRFIP1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LRRFIP1 Lysate

Western Blot: LRRFIP1 Lysate [NBL1-12709] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LRRFIP1
  Novus Biologicals Inc.

LRRFIP1 overexpression lysate

LRRFIP1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn