TA343955 LSM10 antibody

Rabbit Polyclonal Anti-Lsm10 Antibody

See related secondary antibodies

Search for all "LSM10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish LSM10

Product Description for LSM10

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish LSM10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LSM10

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms U7 snRNA-associated Sm-like protein LSm10
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8QZX5
Immunogen:
The immunogen for Anti-Lsm10 antibody is: synthetic peptide directed towards the N-terminal region of Rat Lsm10. Synthetic peptide located within the following region: MALSHSVKERTISENSLIILLQGLQGQITTVDLRDESVARGRIDNVDAFM.
GeneID:
116748
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn