TA338823 LSM12 antibody

Rabbit Polyclonal Anti-LSM12 Antibody

See related secondary antibodies

Search for all "LSM12"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish LSM12

Product Description for LSM12

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish LSM12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LSM12

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3MHD2
Immunogen:
The immunogen for anti-LSM12 antibody: synthetic peptide directed towards the middle region of human LSM12. Synthetic peptide located within the following region: PPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAAL.
GeneID:
124801
Application WB
Background LSM12 belongs to the LSM12 family. The exact function of LSM12 is not known.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LSM12 (5 products)

Catalog No. Species Pres. Purity   Source  

LSM12

LSM12 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

LSM12 (1-195, His-tag)

LSM12 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €730.00
  Acris Antibodies GmbH

LSM12 (1-195, His-tag)

LSM12 Human Purified > 90 % by SDS - PAGE E. coli
20 µg / €300.00
  Acris Antibodies GmbH

LSM12

LSM12 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

LSM12

LSM12 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for LSM12 (2 products)

Catalog No. Species Pres. Purity   Source  

LSM12 Lysate

Western Blot: LSM12 Lysate [NBL1-12723] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LSM12
  Novus Biologicals Inc.

LSM12 overexpression lysate

LSM12 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn