TA333806 LSM14A antibody

Rabbit Polyclonal Anti-LSM14A Antibody

See related secondary antibodies

Search for all "LSM14A"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat LSM14A


More Views

  • TA333806
  • TA333806

Product Description for LSM14A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat LSM14A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LSM14A

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms AlphaSNBP, C19orf13, FAM61A, Protein SCD6 homolog, Putative alpha-synuclein-binding protein, RNA-associated protein 55A, hRAP55, hRAP55A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-LSM14A Antibody: synthetic peptide directed towards the middle region of human LSM14A. Synthetic peptide located within the following region: TSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSP.
Application WB
Background Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mR splicing.Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mR splicing.[supplied by OMIM].
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for LSM14A (4 products)

Catalog No. Species Pres. Purity   Source  

LSM14A (transcript variant 2)

LSM14A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

LSM14A (transcript variant 1)

LSM14A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.


LSM14A Human Purified
  Abnova Taiwan Corp.


LSM14A Human Purified
  Abnova Taiwan Corp.

Positive controls for LSM14A (4 products)

Catalog No. Species Pres. Purity   Source  

LSM14A 293T Cell Transient Overexpression Lysate(Denatured)

LSM14A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LSM14A Lysate

Western Blot: LSM14A Lysate [NBL1-12724] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LSM14A
  Novus Biologicals Inc.

LSM14A overexpression lysate

LSM14A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

LSM14A overexpression lysate

LSM14A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn