discontinued

H00004046-M07 LSP1 / WP34 antibody

See related secondary antibodies

Search for all "LSP1 / WP34"

Quick Overview

Mouse anti Human LSP1 / WP34 1C4

Product Description for LSP1 / WP34

Mouse anti Human LSP1 / WP34 1C4.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for LSP1 / WP34

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms 47 kDa actin-binding protein, 52 kDa phosphoprotein, Lymphocyte-specific antigen WP34, Lymphocyte-specific protein 1, Protein pp52
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1C4
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P33241
Immunogen:
LSP1 (NP_002330, 240 a.a. ~ 339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSG KRYKFVATGHGKYEKVLVEGGPA*
GeneID:
4046
Remarks:
Gene Accession: NM_002339
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant LSP1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 4046

Accessory Products

Proteins and/or Positive Controls

Proteins for LSP1 / WP34 (3 products)

Catalog No. Species Pres. Purity   Source  

LSP1 / WP34 (transcript variant 1)

LSP1 / WP34 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

LSP1 / WP34

LSP1 / WP34 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

LSP1 / WP34

LSP1 / WP34 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for LSP1 / WP34 (3 products)

Catalog No. Species Pres. Purity   Source  

LSP1 293T Cell Transient Overexpression Lysate(Denatured)

LSP1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LSP1 Lysate

Western Blot: LSP1 Lysate [NBL1-12732] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LSP1
  Novus Biologicals Inc.

LSP1 overexpression lysate

LSP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn