TA330314 LSP1 / WP34 antibody

Rabbit Polyclonal Anti-LSP1 Antibody

See related secondary antibodies

Search for all "LSP1 / WP34"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LSP1 / WP34

Product Description for LSP1 / WP34

Rabbit anti Human LSP1 / WP34.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LSP1 / WP34

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms 47 kDa actin-binding protein, 52 kDa phosphoprotein, Lymphocyte-specific antigen WP34, Lymphocyte-specific protein 1, Protein pp52
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P33241
Immunogen:
The immunogen for anti-LSP1 antibody: synthetic peptide directed towards the N terminal of human LSP1. Synthetic peptide located within the following region: CQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWS.
GeneID:
4046
Application WB
Background This protein is an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration.This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Altertive splicing results in multiple transcript variants encoding different isoforms.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LSP1 / WP34 (3 products)

Catalog No. Species Pres. Purity   Source  

LSP1 / WP34 (transcript variant 1)

LSP1 / WP34 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

LSP1 / WP34

LSP1 / WP34 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

LSP1 / WP34

LSP1 / WP34 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for LSP1 / WP34 (3 products)

Catalog No. Species Pres. Purity   Source  

LSP1 293T Cell Transient Overexpression Lysate(Denatured)

LSP1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LSP1 Lysate

Western Blot: LSP1 Lysate [NBL1-12732] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LSP1
  Novus Biologicals Inc.

LSP1 overexpression lysate

LSP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn