NBP1-59440 LST3 antibody

See related secondary antibodies

Search for all "LST3"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LST3

Product Description for LST3

Rabbit anti Human LST3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LST3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms LST3
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Synthetic peptides corresponding to LST-3TM12(organic anion transporter LST-3b) The peptide sequence was selected from the middle region of LST-3TM12. Peptide sequence LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH.
Background The exact function of LST-3TM12 remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 338821

Accessory Products

  • LinkedIn