NBP1-59483 LST3 antibody

See related secondary antibodies

Search for all "LST3"

Quick Overview

Rabbit anti Human LST3

Product Description for LST3

Rabbit anti Human LST3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LST3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms LST3
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Synthetic peptides corresponding to LST-3TM12(organic anion transporter LST-3b) The peptide sequence was selected from the middle region of LST-3TM12. Peptide sequence RAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLE.
Background The exact function of LST-3TM12 remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 338821

Accessory Products

  • LinkedIn