discontinued

H00004060-D01P Lumican antibody

See related secondary antibodies

Search for all "Lumican"

Quick Overview

Rabbit anti Human Lumican

Product Description for Lumican

Rabbit anti Human Lumican.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Lumican

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms KSPG lumican, Keratan sulfate proteoglycan lumican, LDC, LUM, SLRR2D
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P51884
Immunogen:
LUM (NP_002336.1, 1 a.a. ~ 338 a.a) full-length human protein.
AA Sequence:
MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNN QIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKL GSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRF NALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYS KIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
GeneID:
4060
Remarks:
Gene Accession: NM_002345
Add. information Rabbit polyclonal antibody raised against a full-length human LUM protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 4060

Accessory Products

Proteins and/or Positive Controls

Proteins for Lumican (6 products)

Catalog No. Species Pres. Purity   Source  

Lumican

Lumican Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Lumican

Lumican Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €399.00
  OriGene Technologies, Inc.

Lumican (19-338, His-tag)

Lumican Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

Lumican (19-338, His-tag)

Lumican Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

Lumican

Lumican Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Lumican

Lumican Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Lumican (2 products)

Catalog No. Species Pres. Purity   Source  

LUM 293T Cell Transient Overexpression Lysate(Denatured)

LUM 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LUM overexpression lysate

LUM overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn