TA335062 Lumican antibody

Rabbit Polyclonal Anti-LUM Antibody

See related secondary antibodies

Search for all "Lumican"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Lumican

Product Description for Lumican

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Lumican.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Lumican

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms KSPG lumican, Keratan sulfate proteoglycan lumican, LDC, LUM, SLRR2D
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-LUM antibody: synthetic peptide directed towards the middle region of human LUM. Synthetic peptide located within the following region: AFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRF.
Application WB
Background This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctiol molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Lumican (6 products)

Catalog No. Species Pres. Purity   Source  


Lumican Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


Lumican Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 10 µg / €399.00

Special Price: 10 µg / €299.00

  OriGene Technologies, Inc.

Lumican (19-338, His-tag)

Lumican Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

Lumican (19-338, His-tag)

Lumican Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH


Lumican Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


Lumican Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Lumican (2 products)

Catalog No. Species Pres. Purity   Source  

LUM 293T Cell Transient Overexpression Lysate(Denatured)

LUM 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LUM overexpression lysate

LUM overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn