discontinued

H00023659-D01 LYPLA3 antibody

See related secondary antibodies

Search for all "LYPLA3"

Quick Overview

Rabbit anti Human LYPLA3

Product Description for LYPLA3

Rabbit anti Human LYPLA3.
Presentation: Serum
Product is tested for ELISA (detection), Immunoprecipitation.

Properties for LYPLA3

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms 1-O-acylceramide synthase, ACS, LCAT-like lysophospholipase, LPLA2, Lysophospholipase 3, Lysosomal phospholipase A2
Presentation Serum
Reactivity Hu
Applications E(detection), IP
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NCC3
Immunogen:
PLA2G15 (NP_036452.1, 1 a.a. ~ 412 a.a) full-length human protein.
AA Sequence:
MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIW LNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTR GEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGA PWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGF EDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEH QVLLQELPGSEHIEMLANATTLAYLKRVLLGP
GeneID:
23659
Remarks:
Gene Accession: NM_012320.3
Add. information Rabbit polyclonal antibody raised against a full-length human PLA2G15 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IP
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 23659

Accessory Products

Proteins and/or Positive Controls

Proteins for LYPLA3 (6 products)

Catalog No. Species Pres. Purity   Source  

LYPLA3

LYPLA3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

LYPLA3

LYPLA3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

LYPLA3

LYPLA3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

LYPLA3

LYPLA3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

LYPLA3

LYPLA3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

LYPLA3

LYPLA3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for LYPLA3 (2 products)

Catalog No. Species Pres. Purity   Source  

LYPLA3 293T Cell Transient Overexpression Lysate(Denatured)

LYPLA3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LYPLA3 Lysate

Western Blot: LYPLA3 Lysate [NBL1-12762] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PLA2G15
  Novus Biologicals Inc.
  • LinkedIn