NBP1-92091 LYRM5 antibody

See related secondary antibodies

Search for all "LYRM5"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LYRM5

Product Description for LYRM5

Rabbit anti Human LYRM5.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for LYRM5

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6IPR1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LRGEVLKLYKNLLYLGRDYPKGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELEALYFLRKYRAMKQRYYSDTN
GeneID:
144363
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 144363

Accessory Products

Proteins and/or Positive Controls

Positive controls for LYRM5 (2 products)

Catalog No. Species Pres. Purity   Source  

LYRM5 Lysate

Western Blot: LYRM5 Lysate [NBL1-12767] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LYRM5
0.1 mg / €400.00
  Novus Biologicals Inc.

LYRM5 overexpression lysate

LYRM5 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn