NBP1-69234 LYSMD4 antibody

See related secondary antibodies

Search for all "LYSMD4"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LYSMD4

Product Description for LYSMD4

Rabbit anti Human LYSMD4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LYSMD4

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FLJ33008, MGC99501
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NII6
Immunogen:
Synthetic peptides corresponding to LYSMD4(LysM, putative peptidoglycan-binding, domain containing 4) The peptide sequence was selected from the N terminal of LYSMD4. Peptide sequence PRREQVTWCCCSGSWPRRTASTSWRCSMAANTFYFRPNGAGDTRQNLIPD.
GeneID:
145748
Background The specific function of LYSMD4 is not yet known.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 145748

Accessory Products

  • LinkedIn