discontinued

NBP1-69234 LYSMD4 antibody

See related secondary antibodies

Search for all "LYSMD4"

50 µg / €440.00

Quick Overview

Rabbit anti Human LYSMD4

Product Description for LYSMD4

Rabbit anti Human LYSMD4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LYSMD4

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FLJ33008, MGC99501
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NII6
Immunogen:
Synthetic peptides corresponding to LYSMD4(LysM, putative peptidoglycan-binding, domain containing 4) The peptide sequence was selected from the N terminal of LYSMD4. Peptide sequence PRREQVTWCCCSGSWPRRTASTSWRCSMAANTFYFRPNGAGDTRQNLIPD.
GeneID:
145748
Background The specific function of LYSMD4 is not yet known.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 145748

Accessory Products

  • LinkedIn