discontinued

NBP1-59342 Macrophage antibody

See related secondary antibodies

Search for all "Macrophage"

50 µg / €390.00

Quick Overview

Rabbit anti Human Macrophage

Product Description for Macrophage

Rabbit anti Human Macrophage.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Macrophage

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MCSF, MGC31930
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VVF3
Immunogen:
Synthetic peptides corresponding to CSF1(colony stimulating factor 1 (macrophage)) The peptide sequence was selected from the N terminal of CSF1. Peptide sequence PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME.
Background CSF1 is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. CSF1 may be involved in development of the placenta. The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn