discontinued

NBP1-69683 MAGT1 antibody

See related secondary antibodies

Search for all "MAGT1"

50 µg / €440.00

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat MAGT1

Product Description for MAGT1

Rabbit anti Canine, Human, Mouse, Rat MAGT1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for MAGT1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp564K142, FLJ14726, MGC64926, PRO0756, bA217H1.1
Presentation Aff - Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B4DH58
Immunogen:
Synthetic peptides corresponding to RP11-217H1.1 The peptide sequence was selected from the N terminal of RP11-217H1.1. Peptide sequence ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP.
Background The specific function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn