NBP1-69683 MAGT1 antibody

See related secondary antibodies

Search for all "MAGT1"

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat MAGT1

Product Description for MAGT1

Rabbit anti Canine, Human, Mouse, Rat MAGT1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for MAGT1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp564K142, FLJ14726, MGC64926, PRO0756, bA217H1.1
Presentation Aff - Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to RP11-217H1.1 The peptide sequence was selected from the N terminal of RP11-217H1.1. Peptide sequence ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP.
Background The specific function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn