NBP1-57570 MAP4K1 antibody

See related secondary antibodies

Search for all "MAP4K1"

50 µg / €390.00

Quick Overview

Rabbit anti Human, Rat MAP4K1

Product Description for MAP4K1

Rabbit anti Human, Rat MAP4K1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for MAP4K1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to MAP4K1(mitogen-activated protein kinase kinase kinase kinase 1) The peptide sequence was selected from the N terminal of MAP4K1. Peptide sequence VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK.
Background MAP4K1 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. MAP4K1 may play a role in the response to environmental stress. It appears to act upstream of the JUN N-terminal pathway. MAP4K1 may play a role in hematopoietic lineage decisions and growth regulation.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 11184

Accessory Products

  • LinkedIn