H00079929-B01P MAP6D1 antibody

See related secondary antibodies

Search for all "MAP6D1"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human MAP6D1

H00079929-B01P

Product Description for MAP6D1

Mouse anti Human MAP6D1.
Product is tested for Western blot / Immunoblot.

Properties for MAP6D1

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ12748, MAPO6D1, SL21
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H9H5
Immunogen:
MAP6D1 (NP_079147.1, 1 a.a. ~ 199 a.a) full-length human protein.
AA Sequence:
MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYSDLDSEEPGTGGAASRRGQPPAGARDSGRDVPLTQYQRDFGLW TTPAGPKDPPPGRGPGAGGRRGKSSAQSSAPPAPGARGVYVLPIGDADAAAAVTTSYRQEFQAWTGVKPSRSTKTK PARVITTHTSGWDSSPGAGFQVPEVRKKFTPNPSAIFQASAPRILNV
GeneID:
79929
Add. information Mouse polyclonal antibody raised against a full-length human MAP6D1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for MAP6D1 (1 products)

Catalog No. Species Pres. Purity   Source  

MAP6 domain containing 1 (MAP6D1)

MAP6 domain containing 1 (MAP6D1) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn