NBP1-87883 MASP2 antibody

See related secondary antibodies

Search for all "MASP2"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MASP2

Product Description for MASP2

Rabbit anti Human MASP2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for MASP2

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00193
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: INEELESQYQQSMDSKLSGRYRRHCGLGFSEVEDHDGEGDVAGDDDDDD
GeneID:
10944
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 10944

Accessory Products

Proteins and/or Positive Controls

Proteins for MASP2 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 11 open reading frame 58 (C11orf58), transcript variant 1 (transcript variant 1)

Chromosome 11 open reading frame 58 (C11orf58), transcript variant 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for MASP2 (1 products)

Catalog No. Species Pres. Purity   Source  

C11orf58 overexpression lysate

C11orf58 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn