TA346036 MAT1A antibody

Rabbit Polyclonal Anti-MAT1A Antibody

See related secondary antibodies

Search for all "MAT1A"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MAT1A


More Views

  • TA346036

Product Description for MAT1A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MAT1A.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for MAT1A

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms AMS1, AdoMet synthetase 1, MAT 1, MAT-I/III, MATA1, Methionine adenosyltransferase 1, Methionine adenosyltransferase I/III, S-adenosylmethionine synthetase isoform type-1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE.
Application WB
Background MAT1A catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and domint mutations, the latter identified in autosomal domint persistant hypermethioninemia.This gne encodes methionine adenosyltransferase I (alpha isoform), which catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and domint mutations, the latter identified in autosomal domint persistant hypermethioninemia.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for MAT1A (8 products)

Catalog No. Species Pres. Purity   Source  


MAT1A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

MAT1A (1-395, His-tag)

MAT1A Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €1,000.00
  Acris Antibodies GmbH

MAT1A (1-395, His-tag)

MAT1A Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €370.00
  Acris Antibodies GmbH


MAT1A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


MAT1A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


MAT1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


MAT1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


SDS-Page: MAT1A Protein [NBP1-40408] - MAT1A, 45.6 kDa (414aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Liquid
  Novus Biologicals Inc.

Positive controls for MAT1A (2 products)

Catalog No. Species Pres. Purity   Source  

MAT1A Lysate

Western Blot: MAT1A Lysate [NBL1-12909] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MAT1A
  Novus Biologicals Inc.

MAT1A overexpression lysate

MAT1A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn