
NBP1-53142 Matrilin 2 antibody

See related secondary antibodies

Search for all "Matrilin 2"

Quick Overview

Rabbit anti Human Matrilin 2

Product Description for Matrilin 2

Rabbit anti Human Matrilin 2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Matrilin 2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to MATN2(matrilin 2) The peptide sequence was selected from the middle region of MATN2. Peptide sequence AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED.
Background MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.This gene encodes a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn