TA338436 MAVS antibody

Rabbit Polyclonal Anti-MAVS Antibody

See related secondary antibodies

Search for all "MAVS"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MAVS

Product Description for MAVS

Rabbit anti Human MAVS.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MAVS

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CARD adapter inducing interferon-beta, Cardif, IPS1, Mitochondrial antiviral-signaling protein, Mitochondrial antiviral-signaling protein, Putative NF-kappa-B-activating protein 031N, VISA, Virus-induced-signaling adapter, nterferon-beta promoter stimulator protein 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ.
Application WB
Background Double-stranded R viruses are recognized in a cell type-dependent manner by the transmembrane receptor TLR3 or by the cytoplasmic R helicases MDA5 and RIGI (ROBO3). These interactions initiate sigling pathways that differ in their initial steps but converge in the activation of the protein kises IKKA (CHUK) and IKKB (IKBKB), which activate NFKB, or TBK1 and IKKE (IKBKE), which activate IRF3. Activated IRF3 and NFKB induce transcription of IFNB (IFNB1). For the TLR3 pathway, the intermediary molecule before the pathways converge is the cytoplasmic protein TRIF (TICAM1). For RIGI, the intermediary protein is mitochondria-bound VISA. Double-stranded R viruses are recognized in a cell type-dependent manner by the transmembrane receptor TLR3 (MIM 603029) or by the cytoplasmic R helicases MDA5 (MIM 606951) and RIGI (ROBO3; MIM 608630). These interactions initiate sigling pathways that differ in their initial steps but converge in the activation of the protein kises IKKA (CHUK; MIM 600664) and IKKB (IKBKB; MIM 603258), which activate NFKB (see MIM 164011), or TBK1 (MIM 604834) and IKKE (IKBKE; MIM 605048), which activate IRF3 (MIM 603734). Activated IRF3 and NFKB induce transcription of IFNB (IFNB1; MIM 147640). For the TLR3 pathway, the intermediary molecule before the pathways converge is the cytoplasmic protein TRIF (TICAM1; MIM 607601). For RIGI, the intermediary protein is mitochondria-bound IPS1 (Sen and Sarkar, 2005 [PubMed 16239922]).[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for MAVS (6 products)

Catalog No. Species Pres. Purity   Source  


MAVS Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

MAVS (1-513, His-tag)

MAVS Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €730.00
  OriGene Technologies GmbH

MAVS (1-513, His-tag)

MAVS Human Purified > 85 % by SDS - PAGE E. coli
10 µg / €300.00
  OriGene Technologies GmbH


MAVS Human
  Abnova Taiwan Corp.


MAVS Human Purified
  Abnova Taiwan Corp.


MAVS Human Purified
  Abnova Taiwan Corp.

Positive controls for MAVS (2 products)

Catalog No. Species Pres. Purity   Source  

MAVS overexpression lysate

MAVS overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

VISA 293T Cell Transient Overexpression Lysate(Denatured)

VISA 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn