NBP1-81363 MBD6 antibody

See related secondary antibodies

Search for all "MBD6"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MBD6

NBP1-81363

More Views

  • NBP1-81363

Product Description for MBD6

Rabbit anti Human MBD6.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections.

Properties for MBD6

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications ICC/IF, P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96DN6
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MERSPRRTHHWQHNGELAEGGAEPKDPPPPGPHSEDLKVPPGVVRKSRRGRRRKYNPTRNSNSSRQDITLEPSPTARAA
GeneID:
114785
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 114785

Accessory Products

  • LinkedIn