NBP1-84106 MBLAC2 antibody

See related secondary antibodies

Search for all "MBLAC2"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MBLAC2

NBP1-84106

More Views

  • NBP1-84106

Product Description for MBLAC2

Rabbit anti Human MBLAC2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for MBLAC2

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q68D91
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RGDNFETVTWLSDSEVVRAPSPGWRARQFRVQAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLHDKDRKILFSGDVVYDGSLI
GeneID:
153364
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 153364

Accessory Products

Proteins and/or Positive Controls

Positive controls for MBLAC2 (1 products)

Catalog No. Species Pres. Purity   Source  

MBLAC2 Lysate

Western Blot: MBLAC2 Lysate [NBL1-12581] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MBLAC2
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn