TA346698 MBOAT1 antibody

Rabbit Polyclonal Anti-MBOAT1 Antibody

See related secondary antibodies

Search for all "MBOAT1"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human, Mouse, Porcine, Rabbit, Rat MBOAT1

Product Description for MBOAT1

Rabbit anti Equine, Human, Mouse, Porcine, Rabbit, Rat MBOAT1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MBOAT1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 1-acylglycerophosphoserine O-acyltransferase, LPLAT 1, Lysophosphatidylserine acyltransferase, Lysophospholipid acyltransferase 1, Membrane-bound O-acyltransferase domain-containing protein 1, OACT1
Presentation Purified
Reactivity Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-MBOAT1 antibody: synthetic peptide directed towards the N terminal of human MBOAT1. Synthetic peptide located within the following region: AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR.
Application WB
Background This gene belongs to the membrane-bound O-acetyltransferase superfamily. The encoded transmembrane protein is an enzyme that transfers organic compounds, preferably from oleoyl-CoA, to hydroxyl groups of protein targets in membranes. A translocation disrupting this gene may be associated with brachydactyly syndactyly syndrome. Alternately spliced transcript variants have been described for this gene. [provided by RefSeq, Nov 2012].
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for MBOAT1 (2 products)

Catalog No. Species Pres. Purity   Source  


MBOAT1 Human Purified
  Abnova Taiwan Corp.


MBOAT1 Human Purified
  Abnova Taiwan Corp.
  • LinkedIn