discontinued

H00004172-M03 MCM3 antibody

See related secondary antibodies

Search for all "MCM3"

Quick Overview

Mouse anti Human MCM3 3E1

H00004172-M03

More Views

  • H00004172-M03
  • H00004172-M03
  • H00004172-M03

Product Description for MCM3

Mouse anti Human MCM3 3E1.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for MCM3

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DNA polymerase alpha holoenzyme-associated protein P1, DNA replication licensing factor MCM3, P1-MCM3, P102 protein, RLF subunit beta, mini-chromosome maintenance protein 3
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, WB
Clonality Monoclonal
Clone 3E1
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P25205
Immunogen:
MCM3 (NP_002379, 699 a.a. ~ 809 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINR DSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI*
GeneID:
4172
Remarks:
Gene Accession: NM_002388
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant MCM3.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 4172

Accessory Products

Proteins and/or Positive Controls

Proteins for MCM3 (3 products)

Catalog No. Species Pres. Purity   Source  

MCM3

MCM3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

MCM3

MCM3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MCM3

MCM3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MCM3 (2 products)

Catalog No. Species Pres. Purity   Source  

MCM3 Lysate

Western Blot: MCM3 Lysate [NBL1-12951] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MCM3
  Novus Biologicals Inc.

MCM3 overexpression lysate

MCM3 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn