TA341682 MCM3 antibody

Rabbit Polyclonal Anti-MCM3 Antibody

See related secondary antibodies

Search for all "MCM3"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast MCM3

Product Description for MCM3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast MCM3.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for MCM3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DNA polymerase alpha holoenzyme-associated protein P1, DNA replication licensing factor MCM3, P1-MCM3, P102 protein, RLF subunit beta, mini-chromosome maintenance protein 3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ye
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-MCM3 antibody: synthetic peptide directed towards the C terminal of human MCM3. Synthetic peptide located within the following region: YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK.
Application IHC
Background The protein encoded byThis gene is one ofThe highly conserved mini-chromosome maintence proteins (MCM) that are involved inThe initiation of eukaryotic genome replication.The hexameric protein complex formed by MCM proteins is a key component ofThe pre-replication complex (pre_RC) and may be involved inThe formation of replication forks and inThe recruitment of other D replication related proteins.This protein is a subunit ofThe protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46.This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase.The acetylation ofThis protein inhibitsThe initiation of D replication and cell cycle progression. Two transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jul 2012].
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for MCM3 (3 products)

Catalog No. Species Pres. Purity   Source  


MCM3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.


MCM3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


MCM3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MCM3 (2 products)

Catalog No. Species Pres. Purity   Source  

MCM3 Lysate

Western Blot: MCM3 Lysate [NBL1-12951] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MCM3
  Novus Biologicals Inc.

MCM3 overexpression lysate

MCM3 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn