NBP1-58128 MCM9 antibody

See related secondary antibodies

Search for all "MCM9"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse MCM9

Product Description for MCM9

Rabbit anti Human, Mouse MCM9.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for MCM9

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FLJ13942
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B3KV41
Immunogen:
Synthetic peptides corresponding to MCM9(minichromosome maintenance complex component 9) The peptide sequence was selected from the N terminal of MCM9. Peptide sequence NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN.
Background MCM9 is a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.This gene encodes a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn