discontinued

NBP1-58128 MCM9 antibody

See related secondary antibodies

Search for all "MCM9"

Quick Overview

Rabbit anti Human, Mouse MCM9

Product Description for MCM9

Rabbit anti Human, Mouse MCM9.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for MCM9

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FLJ13942
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B3KV41
Immunogen:
Synthetic peptides corresponding to MCM9(minichromosome maintenance complex component 9) The peptide sequence was selected from the N terminal of MCM9. Peptide sequence NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN.
Background MCM9 is a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.This gene encodes a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn