
NBP1-59376 MDM1 antibody

See related secondary antibodies

Search for all "MDM1"

Quick Overview

Rabbit anti Human, Mouse MDM1

Product Description for MDM1

Rabbit anti Human, Mouse MDM1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for MDM1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to MDM1(Mitochondrial deafness modifier 1) The peptide sequence was selected from the N terminal of MDM1. Peptide sequence GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE.
Background MDM1 is a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53. This gene encodes a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53. In mouse several transcripts have been described for this gene which result from alternative polyadenylation, splicing and exon usage.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 56890

Accessory Products

  • LinkedIn