H00084246-B01P MED10 antibody

See related secondary antibodies

Search for all "MED10"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human MED10

H00084246-B01P

Product Description for MED10

Mouse anti Human MED10.
Product is tested for Western blot / Immunoblot.

Properties for MED10

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms L6, MGC5309, NUT2, TRG20
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BTT4
Immunogen:
MED10 (NP_115662.2, 1 a.a. ~ 135 a.a) full-length human protein.
AA Sequence:
MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRN PQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS
GeneID:
84246
Add. information Mouse polyclonal antibody raised against a full-length human MED10 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for MED10 (2 products)

Catalog No. Species Pres. Purity   Source  

MED10

10ug of GTX120912-pro MED10 recombinant protein analyzed using SDS-PAGE and stained with coomassie blue and captured by black and white camera. Purified Purified by conventional chromatography.
25 µg / €360.00
  GeneTex Inc.

Mediator complex subunit 10 (MED10)

Mediator complex subunit 10 (MED10) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for MED10 (2 products)

Catalog No. Species Pres. Purity   Source  

MED10 Lysate

Western Blot: MED10 Lysate [NBL1-12979] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MED10
0.1 mg / €400.00
  Novus Biologicals Inc.

MED10 overexpression lysate

MED10 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn