NBP1-81328 MED10 antibody

See related secondary antibodies

Search for all "MED10"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MED10

Product Description for MED10

Rabbit anti Human MED10.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for MED10

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BTT4
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: FEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS
GeneID:
84246
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 84246

Accessory Products

Proteins and/or Positive Controls

Proteins for MED10 (2 products)

Catalog No. Species Pres. Purity   Source  

MED10

10ug of GTX120912-pro MED10 recombinant protein analyzed using SDS-PAGE and stained with coomassie blue and captured by black and white camera. Purified Purified by conventional chromatography.
25 µg / €360.00
  GeneTex Inc.

Mediator complex subunit 10 (MED10)

Mediator complex subunit 10 (MED10) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for MED10 (2 products)

Catalog No. Species Pres. Purity   Source  

MED10 Lysate

Western Blot: MED10 Lysate [NBL1-12979] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MED10
0.1 mg / €400.00
  Novus Biologicals Inc.

MED10 overexpression lysate

MED10 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn