discontinued

NBP1-81328 MED10 antibody

See related secondary antibodies

Search for all "MED10"

Quick Overview

Rabbit anti Human MED10

Product Description for MED10

Rabbit anti Human MED10.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for MED10

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BTT4
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: FEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS
GeneID:
84246
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 84246

Accessory Products

Proteins and/or Positive Controls

Proteins for MED10 (1 products)

Catalog No. Species Pres. Purity   Source  

Mediator complex subunit 10 (MED10)

Mediator complex subunit 10 (MED10) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for MED10 (2 products)

Catalog No. Species Pres. Purity   Source  

MED10 Lysate

Western Blot: MED10 Lysate [NBL1-12979] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MED10
  Novus Biologicals Inc.

MED10 overexpression lysate

MED10 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn