discontinued

NBP1-93576 MEGF10 antibody

See related secondary antibodies

Search for all "MEGF10"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human MEGF10

Product Description for MEGF10

Rabbit anti Human MEGF10.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for MEGF10

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96KG7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NGGTCDAATGQCHCSPGYTGERCQDECPVGTYGVLCAETCQCVNGGKCYHVSGACLCEAGFAGERCEARLCPEGLYGIKCDKRCPCHLENTHSCHPMSGECACKPGWSGLYCNETCSPGFYGEACQQICSCQNGADCDSVTGKCTCA
GeneID:
84466
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 84466

Accessory Products

Proteins and/or Positive Controls

Positive controls for MEGF10 (1 products)

Catalog No. Species Pres. Purity   Source  

MEGF10 overexpression lysate

MEGF10 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn