NBP1-93576 MEGF10 antibody

See related secondary antibodies

Search for all "MEGF10"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MEGF10

Product Description for MEGF10

Rabbit anti Human MEGF10.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for MEGF10

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96KG7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NGGTCDAATGQCHCSPGYTGERCQDECPVGTYGVLCAETCQCVNGGKCYHVSGACLCEAGFAGERCEARLCPEGLYGIKCDKRCPCHLENTHSCHPMSGECACKPGWSGLYCNETCSPGFYGEACQQICSCQNGADCDSVTGKCTCA
GeneID:
84466
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 84466

Accessory Products

Proteins and/or Positive Controls

Positive controls for MEGF10 (1 products)

Catalog No. Species Pres. Purity   Source  

MEGF10 overexpression lysate

MEGF10 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn