discontinued

H00004212-M03 MEIS2 antibody

See related secondary antibodies

Search for all "MEIS2"

Quick Overview

Mouse anti Human MEIS2 1D1

H00004212-M03

More Views

  • H00004212-M03

Product Description for MEIS2

Mouse anti Human MEIS2 1D1.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for MEIS2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Homeobox protein Meis2
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, WB
Clonality Monoclonal
Clone 1D1
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O14770
Immunogen:
MEIS2 (AAH01516, 1 a.a. ~ 382 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLL ALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVH ELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHA SQSGDNSSEQGDGLDNSVASPGTGDDD
GeneID:
4212
Remarks:
Gene Accession: BC001516
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a full length recombinant MEIS2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 4212

Accessory Products

Proteins and/or Positive Controls

Proteins for MEIS2 (5 products)

Catalog No. Species Pres. Purity   Source  

MEIS2 (transcript variant f)

MEIS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

MEIS2 (transcript variant d)

MEIS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

MEIS2 (transcript variant a)

MEIS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

MEIS2

MEIS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MEIS2

MEIS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MEIS2 (4 products)

Catalog No. Species Pres. Purity   Source  

MEIS2 293T Cell Transient Overexpression Lysate(Denatured)

MEIS2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MEIS2 Lysate

Western Blot: MEIS2 Lysate [NBL1-13002] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MEIS2
  Novus Biologicals Inc.

MEIS2 Lysate

Western Blot: MEIS2 Lysate [NBL1-13003] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MEIS2
  Novus Biologicals Inc.

MEIS2 Lysate

Western Blot: MEIS2 Lysate [NBL1-13004] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MEIS2
  Novus Biologicals Inc.
  • LinkedIn