TA337289 MEIS2 antibody

Rabbit Polyclonal Anti-MEIS2 Antibody

See related secondary antibodies

Search for all "MEIS2"

0.1 mg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MEIS2


More Views

  • TA337289

Product Description for MEIS2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MEIS2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for MEIS2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Homeobox protein Meis2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-MEIS2 antibody: synthetic peptide directed towards the N terminal of human MEIS2. Synthetic peptide located within the following region: HYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELA.
Application WB
Background MEIS2 encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs.
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for MEIS2 (5 products)

Catalog No. Species Pres. Purity   Source  

MEIS2 (transcript variant f)

MEIS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

MEIS2 (transcript variant d)

MEIS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

MEIS2 (transcript variant a)

MEIS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.


MEIS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


MEIS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MEIS2 (4 products)

Catalog No. Species Pres. Purity   Source  

MEIS2 293T Cell Transient Overexpression Lysate(Denatured)

MEIS2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MEIS2 Lysate

Western Blot: MEIS2 Lysate [NBL1-13002] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MEIS2
  Novus Biologicals Inc.

MEIS2 Lysate

Western Blot: MEIS2 Lysate [NBL1-13003] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MEIS2
  Novus Biologicals Inc.

MEIS2 Lysate

Western Blot: MEIS2 Lysate [NBL1-13004] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MEIS2
  Novus Biologicals Inc.
  • LinkedIn