discontinued

H00399818-B01 METTL10 antibody

See related secondary antibodies

Search for all "METTL10"

Quick Overview

Mouse anti Human METTL10

H00399818-B01

More Views

  • H00399818-B01

Product Description for METTL10

Mouse anti Human METTL10.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for METTL10

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms C10orf138, Methyltransferase-like protein 10
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5JPI9
Immunogen:
LOC399818 (AAH26167, 1 a.a. ~ 192 a.a) full-length human protein.
AA Sequence:
MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFREYGDTGEIWFGEESMNRLIRWMQKHK IPLDASVLDIGTGNGVFLVELAKFGFSNITGIDYSPSAIQLSGSIIEKEGLSNIKLKVEDFLNLSTQLSGFHICID KGTFDAISLNPDNAIEKRKQYVKSLSRVLKVKGFFSNNVM
GeneID:
399818
Remarks:
Gene Accession: BC026167
Add. information Mouse polyclonal antibody raised against a full-length human LOC399818 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 399818

Accessory Products

Proteins and/or Positive Controls

Proteins for METTL10 (2 products)

Catalog No. Species Pres. Purity   Source  

METTL10

METTL10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

METTL10

METTL10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for METTL10 (1 products)

Catalog No. Species Pres. Purity   Source  

LOC399818 293T Cell Transient Overexpression Lysate(Denatured)

LOC399818 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn