discontinued

H00399818-B01P METTL10 antibody

See related secondary antibodies

Search for all "METTL10"

Quick Overview

Mouse anti Human METTL10

H00399818-B01P

More Views

  • H00399818-B01P

Product Description for METTL10

Mouse anti Human METTL10.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for METTL10

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms C10orf138, Methyltransferase-like protein 10
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5JPI9
Immunogen:
METTL10 (AAH26167.1, 1 a.a. ~ 192 a.a) full-length human protein.
AA Sequence:
MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFREYGDTGEIWFGEESMNRLIRWMQKHK IPLDASVLDIGTGNGVFLVELAKFGFSNITGIDYSPSAIQLSGSIIEKEGLSNIKLKVEDFLNLSTQLSGFHICID KGTFDAISLNPDNAIEKRKQYVKSLSRVLKVKGFFSNNVM
GeneID:
399818
Remarks:
Gene Accession: BC026167
Add. information Mouse polyclonal antibody raised against a full-length human METTL10 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Gene ID 399818

Accessory Products

Proteins and/or Positive Controls

Proteins for METTL10 (2 products)

Catalog No. Species Pres. Purity   Source  

METTL10

METTL10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

METTL10

METTL10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for METTL10 (1 products)

Catalog No. Species Pres. Purity   Source  

LOC399818 293T Cell Transient Overexpression Lysate(Denatured)

LOC399818 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn